Lineage for d2gtra_ (2gtr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853061Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2853276Protein automated matches [190669] (6 species)
    not a true protein
  7. 2853291Species Human (Homo sapiens) [TaxId:9606] [187771] (5 PDB entries)
  8. 2853292Domain d2gtra_: 2gtr A: [164842]
    automated match to d2fw2a1

Details for d2gtra_

PDB Entry: 2gtr (more details), 1.9 Å

PDB Description: Human chromodomain Y-like protein
PDB Compounds: (A:) Chromodomain Y-like protein

SCOPe Domain Sequences for d2gtra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtra_ c.14.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ryrdivvrkqdgfthillstkssennslnpevmrevqsalstaaaddsklvllsavgsvf
ccgldfiyfirrltddrkrestkmaeairnfvntfiqfkkpiivavngpaiglgasilpl
cdvvwanekawfqtpyttfgqspdgcstvmfpkimggasanemllsgrkltaqeacgkgl
vsqvfwpgtftqevmvrikelascnpvvleeskalvrcnmkmeleqanerecevlkkiwg
saqgmdsmlkylqrkide

SCOPe Domain Coordinates for d2gtra_:

Click to download the PDB-style file with coordinates for d2gtra_.
(The format of our PDB-style files is described here.)

Timeline for d2gtra_: