Lineage for d2fw2a1 (2fw2 A:3-260)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. Protein Chromodomain protein CDY2A [142002] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [142003] (1 PDB entry)
    Uniprot Q9Y6F7 284-541
  8. Domain d2fw2a1: 2fw2 A:3-260 [134231]

Details for d2fw2a1

PDB Entry: 2fw2 (more details), 2.2 Å

PDB Description: catalytic domain of cdy
PDB Compounds: (A:) Testis-specific chromodomain protein Y 2

SCOPe Domain Sequences for d2fw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}
yrdivvkkedgftqivlstrsteknalntevikemvnalnsaaaddsklvlfsaagsvfc
cgldfgyfvrhlrndrntaslemvdtiknfvntfiqfkkpivvsvngpaiglgasilplc
dlvwanekawfqtpyttfgqspdgcssitfpkmmgkasanemliagrkltareacakglv
sqvfltgtftqevmiqikelasynaivleeckalvrcnikleleqanerecevlrkiwss
aqgiesmlkyvenkidef

SCOPe Domain Coordinates for d2fw2a1 are not available.

Timeline for d2fw2a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fw2b_, d2fw2c_, d2fw2d_, d2fw2e_, d2fw2f_