Lineage for d1tafb_ (1taf B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2110Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 2111Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 2179Family a.22.1.3: TBP-associated factors, TAFs [47134] (4 proteins)
  6. 2191Protein TAF(II)62 [47137] (1 species)
  7. 2192Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47138] (1 PDB entry)
  8. 2193Domain d1tafb_: 1taf B: [16482]
    Other proteins in same PDB: d1tafa_

Details for d1tafb_

PDB Entry: 1taf (more details), 2 Å

PDB Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer

SCOP Domain Sequences for d1tafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster)}
mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
vrdidmslkv

SCOP Domain Coordinates for d1tafb_:

Click to download the PDB-style file with coordinates for d1tafb_.
(The format of our PDB-style files is described here.)

Timeline for d1tafb_:

2193
d1tafb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1tafa_