Lineage for d1hiod_ (1hio D:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H4 [47125] (3 species) Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries) 
Domain d1hiod_: 1hio D: [16469]
Other proteins in same PDB: d1hioa_, d1hiob_, d1hioc_
Details for d1hiod_
PDB Entry: 1hio (more details), 3.1 Å
PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only
SCOP Domain Sequences for d1hiod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hiod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
qgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamdv
vyalkrqgrtlygfgg
SCOP Domain Coordinates for d1hiod_:
Click to download the PDB-style file with coordinates for d1hiod_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hiod_:
- d1hiod_ appears in SCOP 1.57
- d1hiod_ appears in the current release, SCOPe 2.08
View in 3D
