SCOP 1.59: Domain d1eqzc_: 1eqz C:

Lineage for d1eqzc_ (1eqz C:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H3 [47122] (3 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries)

8. Domain d1eqzc_: 1eqz C: [16456]
   Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_

Details for d1eqzc_

PDB Entry: 1eqz, 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzc_:

Sequence; same for both SEQRES and ATOM records:

>d1eqzc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
apatggvkkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssa
vmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1eqzc_:

• d1eqzc_ first appeared (with stable ids) in SCOP 1.55
  
• d1eqzc_ appears in SCOP 1.57
  
• d1eqzc_ appears in SCOP 1.61
  
• d1eqzc_ appears in the current release, SCOPe 2.08