Lineage for d1eqzg_ (1eqz G:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96049Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 96050Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 96051Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 96085Protein Histone H3 [47122] (3 species)
  7. 96094Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries)
  8. 96098Domain d1eqzg_: 1eqz G: [16457]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzd_, d1eqze_, d1eqzf_, d1eqzh_

Details for d1eqzg_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzg_ a.22.1.1 (G:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
prkqlatkaarksapatggvkkphryrpgtvalreirryqkstellirklpfqrlvreia
qdfktdlrfqssavmalqeaseaylvglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1eqzg_:

Click to download the PDB-style file with coordinates for d1eqzg_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzg_: