Lineage for d1eqzd_ (1eqz D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96049Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 96050Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 96051Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 96101Protein Histone H4 [47125] (4 species)
  7. 96108Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)
  8. 96111Domain d1eqzd_: 1eqz D: [16466]
    Other proteins in same PDB: d1eqza_, d1eqzb_, d1eqzc_, d1eqze_, d1eqzf_, d1eqzg_

Details for d1eqzd_

PDB Entry: 1eqz (more details), 2.5 Å

PDB Description: x-ray structure of the nucleosome core particle at 2.5 a resolution

SCOP Domain Sequences for d1eqzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqzd_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
gakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyt
ehakrktvtamdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d1eqzd_:

Click to download the PDB-style file with coordinates for d1eqzd_.
(The format of our PDB-style files is described here.)

Timeline for d1eqzd_: