Lineage for d1hq3c_ (1hq3 C:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96049Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 96050Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 96051Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 96085Protein Histone H3 [47122] (3 species)
  7. 96094Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries)
  8. 96095Domain d1hq3c_: 1hq3 C: [16454]
    Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3d_, d1hq3e_, d1hq3f_, d1hq3h_

Details for d1hq3c_

PDB Entry: 1hq3 (more details), 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq3c_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
yrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseayl
vglfedtnlcaihakrvtimpkdiqlarrirgera

SCOP Domain Coordinates for d1hq3c_:

Click to download the PDB-style file with coordinates for d1hq3c_.
(The format of our PDB-style files is described here.)

Timeline for d1hq3c_: