SCOP 1.59: Domain d1hq3f_: 1hq3 F:

Lineage for d1hq3f_ (1hq3 F:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H2B [47119] (3 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries)

8. Domain d1hq3f_: 1hq3 F: [16445]
   Other proteins in same PDB: d1hq3a_, d1hq3c_, d1hq3d_, d1hq3e_, d1hq3g_, d1hq3h_

Details for d1hq3f_

PDB Entry: 1hq3, 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3f_:

Sequence; same for both SEQRES and ATOM records:

>d1hq3f_ a.22.1.1 (F:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytssk

Timeline for d1hq3f_:

• d1hq3f_ first appeared (with stable ids) in SCOP 1.55
  
• d1hq3f_ appears in SCOP 1.57
  
• d1hq3f_ appears in SCOP 1.61
  
• d1hq3f_ appears in the current release, SCOPe 2.08