SCOP 1.59: Domain d1hq3d_: 1hq3 D:

Lineage for d1hq3d_ (1hq3 D:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)

6. Protein Histone H4 [47125] (4 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (4 PDB entries)

8. Domain d1hq3d_: 1hq3 D: [16464]
   Other proteins in same PDB: d1hq3a_, d1hq3b_, d1hq3c_, d1hq3e_, d1hq3f_, d1hq3g_

Details for d1hq3d_

PDB Entry: 1hq3, 2.15 Å

PDB Description: crystal structure of the histone-core-octamer in kcl/phosphate

SCOP Domain Sequences for d1hq3d_:

Sequence; same for both SEQRES and ATOM records:

>d1hq3d_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d1hq3d_:

• d1hq3d_ first appeared (with stable ids) in SCOP 1.55
  
• d1hq3d_ appears in SCOP 1.57
  
• d1hq3d_ appears in SCOP 1.61
  
• d1hq3d_ appears in the current release, SCOPe 2.08