|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (4 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H2B [47119] (6 species) | 
|  | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries) | 
|  | Domain d1f66h_: 1f66 H: [16451] Other proteins in same PDB: d1f66a_, d1f66b_, d1f66c_, d1f66e_, d1f66f_, d1f66g_ protein/DNA complex; complexed with mn | 
PDB Entry: 1f66 (more details), 2.6 Å
SCOPe Domain Sequences for d1f66h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1f66h_: