Lineage for d1f66h_ (1f66 H:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H2B [47119] (2 species) 
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (2 PDB entries) 
Domain d1f66h_: 1f66 H: [16451]
Other proteins in same PDB: d1f66a_, d1f66b_, d1f66c_, d1f66e_, d1f66f_, d1f66g_
Details for d1f66h_
PDB Entry: 1f66 (more details), 2.6 Å
PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
SCOP Domain Sequences for d1f66h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak
SCOP Domain Coordinates for d1f66h_:
Click to download the PDB-style file with coordinates for d1f66h_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f66h_:
- d1f66h_ appears in SCOP 1.57
- d1f66h_ appears in the current release, SCOPe 2.08
View in 3D
