Lineage for d1f66c_ (1f66 C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082623Protein Histone H2A [47115] (6 species)
  7. 1082711Species Human (Homo sapiens), variant H2A.Z [TaxId:9606] [47118] (1 PDB entry)
  8. 1082712Domain d1f66c_: 1f66 C: [16442]
    Other proteins in same PDB: d1f66a_, d1f66b_, d1f66d_, d1f66e_, d1f66f_, d1f66h_
    protein/DNA complex; complexed with mn

Details for d1f66c_

PDB Entry: 1f66 (more details), 2.6 Å

PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
PDB Compounds: (C:) histone h2a.z

SCOPe Domain Sequences for d1f66c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]}
avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
lkvkritprhlqlairgdeeldslikatiagggviphihksli

SCOPe Domain Coordinates for d1f66c_:

Click to download the PDB-style file with coordinates for d1f66c_.
(The format of our PDB-style files is described here.)

Timeline for d1f66c_: