Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (6 species) |
Species Human (Homo sapiens), variant H2A.Z [TaxId:9606] [47118] (1 PDB entry) |
Domain d1f66c_: 1f66 C: [16442] Other proteins in same PDB: d1f66a_, d1f66b_, d1f66d_, d1f66e_, d1f66f_, d1f66h_ protein/DNA complex; complexed with mn |
PDB Entry: 1f66 (more details), 2.6 Å
SCOPe Domain Sequences for d1f66c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd lkvkritprhlqlairgdeeldslikatiagggviphihksli
Timeline for d1f66c_: