SCOPe 2.01: Domain d2fk3d_: 2fk3 D:

Lineage for d2fk3d_ (2fk3 D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (1 family)

5. Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)

6. Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)

8. Domain d2fk3d_: 2fk3 D: [164416]
   automated match to d1owta_
   complexed with cu

Details for d2fk3d_

PDB Entry: 2fk3, 2.4 Å

PDB Description: structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form

PDB Compounds: (D:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fk3d_:

Sequence; same for both SEQRES and ATOM records:

>d2fk3d_ d.230.3.1 (D:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl

Timeline for d2fk3d_:

• d2fk3d_ is new in SCOPe 2.01-stable
  
• d2fk3d_ appears in SCOPe 2.02
  
• d2fk3d_ appears in the current release, SCOPe 2.08, called d2fk3d1