Lineage for d2fk3c_ (2fk3 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051631Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1051776Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (1 family) (S)
  5. 1051777Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 1051778Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 1051779Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 1051785Domain d2fk3c_: 2fk3 C: [164415]
    automated match to d1owta_
    complexed with cu

Details for d2fk3c_

PDB Entry: 2fk3 (more details), 2.4 Å

PDB Description: structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
PDB Compounds: (C:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fk3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk3c_ d.230.3.1 (C:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
eackflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl

SCOPe Domain Coordinates for d2fk3c_:

Click to download the PDB-style file with coordinates for d2fk3c_.
(The format of our PDB-style files is described here.)

Timeline for d2fk3c_: