Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) automatically mapped to Pfam PF12924 |
Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins) |
Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries) |
Domain d2fk3d1: 2fk3 D:133-189 [164416] Other proteins in same PDB: d2fk3a2, d2fk3b2, d2fk3c2, d2fk3d2, d2fk3e2, d2fk3f2, d2fk3g2, d2fk3h2 automated match to d1owta_ complexed with cu |
PDB Entry: 2fk3 (more details), 2.4 Å
SCOPe Domain Sequences for d2fk3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk3d1 d.230.3.1 (D:133-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]} ckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefvccpl
Timeline for d2fk3d1: