SCOP 1.73: Domain d2hioa_: 2hio A:

Lineage for d2hioa_ (2hio A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (5 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)

8. Domain d2hioa_: 2hio A: [16438]
   Other proteins in same PDB: d2hiob_, d2hioc_, d2hiod_

Details for d2hioa_

PDB Entry: 2hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

PDB Compounds: (A:) protein (histone h2a)

SCOP Domain Sequences for d2hioa_:

Sequence; same for both SEQRES and ATOM records:

>d2hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl

Timeline for d2hioa_:

• d2hioa_ first appeared (with stable ids) in SCOP 1.55
  
• d2hioa_ appears in SCOP 1.71
  
• d2hioa_ appears in SCOP 1.75
  
• d2hioa_ appears in the current release, SCOPe 2.08