|  | Class a: All alpha proteins [46456] (202 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (3 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H2A [47115] (4 species) | 
|  | Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries) | 
|  | Domain d2hioa_: 2hio A: [16438] Other proteins in same PDB: d2hiob_, d2hioc_, d2hiod_ | 
PDB Entry: 2hio (more details), 3.1 Å
SCOP Domain Sequences for d2hioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl
Timeline for d2hioa_: