Lineage for d2hioa_ (2hio A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279050Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 279051Protein Histone H2A [47115] (4 species)
  7. 279070Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (4 PDB entries)
  8. 279075Domain d2hioa_: 2hio A: [16438]
    Other proteins in same PDB: d2hiob_, d2hioc_, d2hiod_

Details for d2hioa_

PDB Entry: 2hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

SCOP Domain Sequences for d2hioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hioa_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes}
ksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgkvtiaqggvlpniqavl

SCOP Domain Coordinates for d2hioa_:

Click to download the PDB-style file with coordinates for d2hioa_.
(The format of our PDB-style files is described here.)

Timeline for d2hioa_: