Lineage for d1hrya_ (1hry A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2075Fold a.21: HMG-box [47094] (1 superfamily)
  4. 2076Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 2077Family a.21.1.1: HMG-box [47096] (7 proteins)
  6. 2106Protein SRY [47104] (1 species)
  7. 2107Species Human (Homo sapiens) [TaxId:9606] [47105] (2 PDB entries)
  8. 2108Domain d1hrya_: 1hry A: [16429]

Details for d1hrya_

PDB Entry: 1hry (more details)

PDB Description: the 3d structure of the human sry-dna complex solved by multid- dimensional heteronuclear-edited and-filtered nmr

SCOP Domain Sequences for d1hrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrya_ a.21.1.1 (A:) SRY {Human (Homo sapiens)}
drvkrpmnafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqklq
amhrekypnykyr

SCOP Domain Coordinates for d1hrya_:

Click to download the PDB-style file with coordinates for d1hrya_.
(The format of our PDB-style files is described here.)

Timeline for d1hrya_: