SCOPe 2.01: Domain d2f8qa_: 2f8q A:

Lineage for d2f8qa_ (2f8q A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (11 species)
   not a true protein

7. Species Bacillus sp. [TaxId:65673] [187690] (2 PDB entries)

8. Domain d2f8qa_: 2f8q A: [164282]
   automated match to d1hiza_
   complexed with mg

Details for d2f8qa_

PDB Entry: 2f8q, 2.2 Å

PDB Description: an alkali thermostable f/10 xylanase from alkalophilic bacillus sp. ng-27

PDB Compounds: (A:) alkaline thermostable endoxylanase

SCOPe Domain Sequences for d2f8qa_:

Sequence; same for both SEQRES and ATOM records:

>d2f8qa_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]}
qpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpeeg
vftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqankel
llerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafet
arkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptidei
rtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyeel
dadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

Timeline for d2f8qa_:

• d2f8qa_ is new in SCOPe 2.01-stable
  
• d2f8qa_ appears in SCOPe 2.02
  
• d2f8qa_ appears in the current release, SCOPe 2.08