SCOPe 2.04: Domain d2ehta_: 2eht A:

Lineage for d2ehta_ (2eht A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (8 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [187667] (2 PDB entries)

8. Domain d2ehta_: 2eht A: [164043]
   automated match to d1acpa_
   complexed with cl, zn

Details for d2ehta_

PDB Entry: 2eht, 1.4 Å

PDB Description: crystal structure of acyl carrier protein from aquifex aeolicus (form 2)

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2ehta_:

Sequence; same for both SEQRES and ATOM records:

>d2ehta_ a.28.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek
iqtvgdvinylkekvgg

Timeline for d2ehta_:

• d2ehta_ first appeared in SCOPe 2.01
  
• d2ehta_ appears in SCOPe 2.03
  
• d2ehta_ appears in SCOPe 2.05
  
• d2ehta_ appears in the current release, SCOPe 2.08