Lineage for d2ehta_ (2eht A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487379Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1487438Protein automated matches [190286] (8 species)
    not a true protein
  7. 1487446Species Aquifex aeolicus [TaxId:224324] [187667] (2 PDB entries)
  8. 1487448Domain d2ehta_: 2eht A: [164043]
    automated match to d1acpa_
    complexed with cl, zn

Details for d2ehta_

PDB Entry: 2eht (more details), 1.4 Å

PDB Description: crystal structure of acyl carrier protein from aquifex aeolicus (form 2)
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2ehta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehta_ a.28.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek
iqtvgdvinylkekvgg

SCOPe Domain Coordinates for d2ehta_:

Click to download the PDB-style file with coordinates for d2ehta_.
(The format of our PDB-style files is described here.)

Timeline for d2ehta_: