![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein automated matches [190286] (7 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:224324] [187667] (2 PDB entries) |
![]() | Domain d2ehta_: 2eht A: [164043] automated match to d1acpa_ complexed with cl, zn |
PDB Entry: 2eht (more details), 1.4 Å
SCOPe Domain Sequences for d2ehta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehta_ a.28.1.1 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]} sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek iqtvgdvinylkekvgg
Timeline for d2ehta_: