PDB entry 2eht

View 2eht on RCSB PDB site
Description: Crystal structure of acyl carrier protein from Aquifex aeolicus (form 2)
Class: lipid transport
Keywords: LIPID TRANSPORT, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-03-08, released 2007-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.196
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Aquifex aeolicus [TaxId:224324]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O67611 (0-76)
  Domains in SCOPe 2.04: d2ehta_
• Heterogens: ZN, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ehtA (A:)
  sleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaek
  iqtvgdvinylkekvgg