![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.106: SurE-like [64166] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7 |
![]() | Superfamily c.106.1: SurE-like [64167] (2 families) ![]() some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family |
![]() | Family c.106.1.0: automated matches [191430] (1 protein) not a true family |
![]() | Protein automated matches [190619] (7 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187651] (6 PDB entries) |
![]() | Domain d2e6gj_: 2e6g J: [163877] automated match to d1ilva_ complexed with po4 |
PDB Entry: 2e6g (more details), 2.6 Å
SCOPe Domain Sequences for d2e6gj_:
Sequence, based on SEQRES records: (download)
>d2e6gj_ c.106.1.0 (J:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
>d2e6gj_ c.106.1.0 (J:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrilvtnddgiyspglwalaeaasqfgevfvaapdahpvrayphpspphfpayrvrgtpa dcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvplngev pdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipgedpmgr pfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
Timeline for d2e6gj_: