PDB entry 2e6g

View 2e6g on RCSB PDB site
Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with phosphate
Class: Hydrolase
Keywords: SurE protein, complexed with phosphate ion, Hydrolase
Deposited on 2006-12-26, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6ga_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gb_
  • Chain 'C':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gc_
  • Chain 'D':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gd_
  • Chain 'E':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6ge_
  • Chain 'F':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gf_
  • Chain 'G':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gg_
  • Chain 'H':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gh_
  • Chain 'I':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gi_
  • Chain 'J':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gj_
  • Chain 'K':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gk_
  • Chain 'L':
    Compound: 5'-nucleotidase sure
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e6gl_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2e6gA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gA (A:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdahpvrayphpspaphfpayrvrgtp
    adcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpgevp
    dfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipgedpmgrp
    fywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2e6gB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gB (B:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapiahpvrayphpsplhaphfpayrvrg
    tpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpln
    gevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipgedp
    mgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2e6gC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gC (C:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapditiahpvrayphpspphfpayrvrg
    tpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpln
    gevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipgedp
    mgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e6gD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gD (D:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapditiahpvrayphpsplhaphfpayr
    vrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsv
    plngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipg
    edpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2e6gE (E:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gE (E:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdttiahpvrayphpspaphfpayrvr
    gtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpl
    ngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipged
    pmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptlahd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2e6gF (F:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gF (F:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdttiahpvrayphpsplaphfpayrv
    rgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvp
    lngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipge
    dpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2e6gG (G:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gG (G:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdtitiahpvrayphpsplhaphfpay
    rvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafs
    vplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvip
    gedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2e6gH (H:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gH (H:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdtetiahpvrayphpsplhaphfpay
    rvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafs
    vplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvip
    gedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2e6gI (I:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gI (I:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdtiahpvrayphpsplaphfpayrvr
    gtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpl
    ngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipged
    pmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2e6gJ (J:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gJ (J:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdahpvrayphpspphfpayrvrgtpa
    dcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvplngev
    pdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipgedpmgr
    pfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2e6gK (K:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gK (K:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdtitiahpvrayphpspphfpayrvr
    gtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpl
    ngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipged
    pmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2e6gL (L:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
    haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
    glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
    ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
    lahd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e6gL (L:)
    mrilvtnddgiyspglwalaeaasqfgevfvaapdttiahpvrayphpsplhaphfpayr
    vrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsv
    plngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipg
    edpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlq