Lineage for d2e6gk_ (2e6g K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919337Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2919338Protein automated matches [190619] (7 species)
    not a true protein
  7. 2919385Species Thermus thermophilus HB8 [TaxId:300852] [187651] (6 PDB entries)
  8. 2919416Domain d2e6gk_: 2e6g K: [163878]
    automated match to d1ilva_
    complexed with po4

Details for d2e6gk_

PDB Entry: 2e6g (more details), 2.6 Å

PDB Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with phosphate
PDB Compounds: (K:) 5'-nucleotidase sure

SCOPe Domain Sequences for d2e6gk_:

Sequence, based on SEQRES records: (download)

>d2e6gk_ c.106.1.0 (K:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl

Sequence, based on observed residues (ATOM records): (download)

>d2e6gk_ c.106.1.0 (K:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdtitiahpvrayphpspphfpayrvr
gtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvpl
ngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipged
pmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl

SCOPe Domain Coordinates for d2e6gk_:

Click to download the PDB-style file with coordinates for d2e6gk_.
(The format of our PDB-style files is described here.)

Timeline for d2e6gk_: