Lineage for d2e0ob_ (2e0o B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399946Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1399947Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1399948Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1400307Protein automated matches [190061] (4 species)
    not a true protein
  7. 1400428Species Human (Homo sapiens) [TaxId:9606] [186903] (6 PDB entries)
  8. 1400438Domain d2e0ob_: 2e0o B: [163790]
    automated match to d1dzaa_
    complexed with gol, so4; mutant

Details for d2e0ob_

PDB Entry: 2e0o (more details), 2 Å

PDB Description: mutant human ribonuclease 1 (v52l, d53l, n56l, f59l)
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2e0ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0ob_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkesrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplllvqlvcl
qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
fdasv

SCOPe Domain Coordinates for d2e0ob_:

Click to download the PDB-style file with coordinates for d2e0ob_.
(The format of our PDB-style files is described here.)

Timeline for d2e0ob_: