SCOPe 2.02: Domain d2e0ob_: 2e0o B:

Lineage for d2e0ob_ (2e0o B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186903] (6 PDB entries)

8. Domain d2e0ob_: 2e0o B: [163790]
   automated match to d1dzaa_
   complexed with gol, so4; mutant

Details for d2e0ob_

PDB Entry: 2e0o, 2 Å

PDB Description: mutant human ribonuclease 1 (v52l, d53l, n56l, f59l)

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2e0ob_:

Sequence; same for both SEQRES and ATOM records:

>d2e0ob_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkesrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplllvqlvcl
qekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvh
fdasv

Timeline for d2e0ob_:

• d2e0ob_ first appeared in SCOPe 2.01
  
• d2e0ob_ appears in SCOPe 2.03
  
• d2e0ob_ appears in the current release, SCOPe 2.08, called d2e0ob1