SCOPe 2.08: Domain d2e0ob1: 2e0o B:1-124

Lineage for d2e0ob1 (2e0o B:1-124)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)

8. Domain d2e0ob1: 2e0o B:1-124 [163790]
   Other proteins in same PDB: d2e0ob2
   automated match to d1dzaa_
   complexed with gol, so4; mutant

Details for d2e0ob1

PDB Entry: 2e0o, 2 Å

PDB Description: mutant human ribonuclease 1 (v52l, d53l, n56l, f59l)

PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2e0ob1:

Sequence; same for both SEQRES and ATOM records:

>d2e0ob1 d.5.1.1 (B:1-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplllvqlvclq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
dasv

Timeline for d2e0ob1:

• d2e0ob1 first appeared in SCOPe 2.01, called d2e0ob_
  
• d2e0ob1 appears in SCOPe 2.07