SCOP 1.55: Domain d2erl__: 2erl -

Lineage for d2erl__ (2erl -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.10: Protozoan pheromone proteins [47013] (1 superfamily)

4. Superfamily a.10.1: Protozoan pheromone proteins [47014] (1 family)

5. Family a.10.1.1: Protozoan pheromone proteins [47015] (5 proteins)

6. Protein ER-1 [47016] (1 species)

7. Species Euplotes raikovi [TaxId:5938] [47017] (2 PDB entries)

8. Domain d2erl__: 2erl - [16360]

Details for d2erl__

PDB Entry: 2erl, 1 Å

PDB Description: pheromone er-1 from

SCOP Domain Sequences for d2erl__:

Sequence; same for both SEQRES and ATOM records:

>d2erl__ a.10.1.1 (-) ER-1 {Euplotes raikovi}
daceqaaiqcvesaceslctegedrtgcymyiysncppyv

Timeline for d2erl__:

• d2erl__ appears in SCOP 1.57
  
• d2erl__ appears in the current release, SCOPe 2.08, called d2erla_