![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Streptococcus suis [TaxId:1307] [187539] (1 PDB entry) |
![]() | Domain d2cf7c_: 2cf7 C: [163383] automated match to d1umng_ complexed with ca, cl, epe; mutant |
PDB Entry: 2cf7 (more details), 1.5 Å
SCOPe Domain Sequences for d2cf7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cf7c_ a.25.1.1 (C:) automated matches {Streptococcus suis [TaxId: 1307]} sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgylaemserl itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg dsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d2cf7c_: