![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries) |
![]() | Domain d1umng_: 1umn G: [99613] complexed with ca, cl, epe |
PDB Entry: 1umn (more details), 1.95 Å
SCOPe Domain Sequences for d1umng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umng_ a.25.1.1 (G:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} qspaeiasfsprpsladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeyme eidgyldemserlitlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaa lfqkgfdvsdeegdsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d1umng_: