SCOPe 2.07: Domain d2cb0b1: 2cb0 B:1-325

Lineage for d2cb0b1 (2cb0 B:1-325)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (4 families)

5. Family c.80.1.0: automated matches [191405] (1 protein)
   not a true family

6. Protein automated matches [190547] (16 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [187527] (1 PDB entry)

8. Domain d2cb0b1: 2cb0 B:1-325 [163355]
   Other proteins in same PDB: d2cb0b2
   automated match to d1j5xa_
   complexed with gol

Details for d2cb0b1

PDB Entry: 2cb0, 1.8 Å

PDB Description: crystal structure of glucosamine 6-phosphate deaminase from pyrococcus furiosus

PDB Compounds: (B:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2cb0b1:

Sequence; same for both SEQRES and ATOM records:

>d2cb0b1 c.80.1.0 (B:1-325) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mktlteikqtpkgiikadesfnqvkdkirlprrilylgcgsshflakllamvtnmhggtg
valpcseflyskeaypigkpelvvgisrsgettevllalekintpklgisayessltrac
dyslvvptieesvvmthsftafyfaylqllrhsyglplleatevakatekaleyenyike
ivedfdfqnviflgsgllypvaleaslkmkemaifwseayptfevrhgfkaiadentlvv
lmaqelfewhkklvnefkgqrarvllisnsqqefgqdysievprlskdatpipylpvvql
lsyykavarglnpdnprfldkvvrw

Timeline for d2cb0b1:

• d2cb0b1 first appeared in SCOPe 2.01, called d2cb0b_
  
• d2cb0b1 appears in SCOPe 2.06
  
• d2cb0b1 appears in the current release, SCOPe 2.08