Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.0: automated matches [191405] (1 protein) not a true family |
Protein automated matches [190547] (16 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [187527] (1 PDB entry) |
Domain d2cb0a_: 2cb0 A: [163354] Other proteins in same PDB: d2cb0b2 automated match to d1j5xa_ complexed with gol |
PDB Entry: 2cb0 (more details), 1.8 Å
SCOPe Domain Sequences for d2cb0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cb0a_ c.80.1.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mktlteikqtpkgiikadesfnqvkdkirlprrilylgcgsshflakllamvtnmhggtg valpcseflyskeaypigkpelvvgisrsgettevllalekintpklgisayessltrac dyslvvptieesvvmthsftafyfaylqllrhsyglplleatevakatekaleyenyike ivedfdfqnviflgsgllypvaleaslkmkemaifwseayptfevrhgfkaiadentlvv lmaqelfewhkklvnefkgqrarvllisnsqqefgqdysievprlskdatpipylpvvql lsyykavarglnpdnprfld
Timeline for d2cb0a_: