Lineage for d2cb0a_ (2cb0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515496Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2515497Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2515715Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2515716Protein automated matches [190547] (16 species)
    not a true protein
  7. 2515793Species Pyrococcus furiosus [TaxId:2261] [187527] (1 PDB entry)
  8. 2515794Domain d2cb0a_: 2cb0 A: [163354]
    Other proteins in same PDB: d2cb0b2
    automated match to d1j5xa_
    complexed with gol

Details for d2cb0a_

PDB Entry: 2cb0 (more details), 1.8 Å

PDB Description: crystal structure of glucosamine 6-phosphate deaminase from pyrococcus furiosus
PDB Compounds: (A:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2cb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cb0a_ c.80.1.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 2261]}
mktlteikqtpkgiikadesfnqvkdkirlprrilylgcgsshflakllamvtnmhggtg
valpcseflyskeaypigkpelvvgisrsgettevllalekintpklgisayessltrac
dyslvvptieesvvmthsftafyfaylqllrhsyglplleatevakatekaleyenyike
ivedfdfqnviflgsgllypvaleaslkmkemaifwseayptfevrhgfkaiadentlvv
lmaqelfewhkklvnefkgqrarvllisnsqqefgqdysievprlskdatpipylpvvql
lsyykavarglnpdnprfld

SCOPe Domain Coordinates for d2cb0a_:

Click to download the PDB-style file with coordinates for d2cb0a_.
(The format of our PDB-style files is described here.)

Timeline for d2cb0a_: