Lineage for d2c8hc_ (2c8h C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000572Protein automated matches [190133] (8 species)
    not a true protein
  7. 3000602Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries)
  8. 3000608Domain d2c8hc_: 2c8h C: [163320]
    automated match to d1g24a_
    complexed with nad, so4; mutant

Details for d2c8hc_

PDB Entry: 2c8h (more details), 1.65 Å

PDB Description: structure of the pn loop q182a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)
PDB Compounds: (C:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c8hc_ d.166.1.1 (C:) automated matches {Clostridium botulinum [TaxId: 1491]}
ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
nkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhsty
hiddmrlssdgkqiiitatmmgtainpk

SCOPe Domain Coordinates for d2c8hc_:

Click to download the PDB-style file with coordinates for d2c8hc_.
(The format of our PDB-style files is described here.)

Timeline for d2c8hc_: