PDB entry 2c8h

View 2c8h on RCSB PDB site
Description: structure of the pn loop q182a mutant c3bot1 exoenzyme (nad-bound state, crystal form I)
Class: transferase
Keywords: c3 exoenzyme, artt motif, ADP-ribosyltransferase, bacterial toxins, pn loop, nad, glycosyltransferase, transferase
Deposited on 2005-12-03, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.218
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (141)
    Domains in SCOPe 2.08: d2c8ha_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (141)
    Domains in SCOPe 2.08: d2c8hb_
  • Chain 'C':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879 (Start-210)
      • engineered mutation (141)
    Domains in SCOPe 2.08: d2c8hc_
  • Chain 'D':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15879
      • engineered mutation (141)
    Domains in SCOPe 2.08: d2c8hd_
  • Heterogens: NAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c8hA (A:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8hA (A:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmgta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c8hB (B:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8hB (B:)
    tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
    ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
    kdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhstyh
    iddmrlssdgkqiiitatmmgtain
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c8hC (C:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8hC (C:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmgtainpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c8hD (D:)
    aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
    psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
    kflnkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprh
    styhiddmrlssdgkqiiitatmmgtainpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c8hD (D:)
    ntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsn
    likqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfl
    nkdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhsty
    hiddmrlssdgkqiiitatmmgta