Lineage for d2c1ma_ (2c1m A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2006475Species Mouse (Mus musculus) [TaxId:10090] [186790] (4 PDB entries)
  8. 2006478Domain d2c1ma_: 2c1m A: [163227]
    automated match to d1ejli_

Details for d2c1ma_

PDB Entry: 2c1m (more details), 2.2 Å

PDB Description: nup50:importin-alpha complex
PDB Compounds: (A:) importin-alpha2 subunit

SCOPe Domain Sequences for d2c1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ma_ a.118.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
yfsv

SCOPe Domain Coordinates for d2c1ma_:

Click to download the PDB-style file with coordinates for d2c1ma_.
(The format of our PDB-style files is described here.)

Timeline for d2c1ma_: