PDB entry 2c1m

View 2c1m on RCSB PDB site
Description: nup50:importin-alpha complex
Class: protein transport/membrane protein
Keywords: protein transport/membrane protein, nuclear transport/complex, importin-alpha, nucleoporin nup50, nuclear transport/complex nup50, nuclear protein, protein transport
Deposited on 2005-09-16, released 2005-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin-alpha2 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c1ma_
  • Chain 'B':
    Compound: nucleoporin 50 kda
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1mA (A:)
    nwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcs
    piqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdgs
    afrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqilp
    tlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpal
    raignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvv
    nhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdt
    kiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliek
    yfsv
    

  • Chain 'B':
    No sequence available.