Lineage for d1quua1 (1quu A:4-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2308818Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2308819Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
  6. 2308820Protein alpha-actinin [46971] (1 species)
  7. 2308821Species Human (Homo sapiens) [TaxId:9606] [46972] (2 PDB entries)
  8. 2308822Domain d1quua1: 1quu A:4-124 [16320]
    Other proteins in same PDB: d1quua3
    two central spectrin-like repeats

Details for d1quua1

PDB Entry: 1quu (more details), 2.5 Å

PDB Description: crystal structure of two central spectrin-like repeats from alpha- actinin
PDB Compounds: (A:) human skeletal muscle alpha-actinin 2

SCOPe Domain Sequences for d1quua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quua1 a.7.1.1 (A:4-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}
neirrlerlehlaekfrqkasthetwaygkeqillqkdyesasltevrallrkheafesd
laahqdrveqiaaiaqelneldyhdavnvndrcqkicdqwdrlgtltqkrrealermekl
l

SCOPe Domain Coordinates for d1quua1:

Click to download the PDB-style file with coordinates for d1quua1.
(The format of our PDB-style files is described here.)

Timeline for d1quua1: