Lineage for d1quua2 (1quu A:125-248)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696504Superfamily a.7.1: Spectrin repeat [46966] (2 families) (S)
  5. 2696505Family a.7.1.1: Spectrin repeat [46967] (3 proteins)
    this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
  6. 2696506Protein alpha-actinin [46971] (1 species)
  7. 2696507Species Human (Homo sapiens) [TaxId:9606] [46972] (3 PDB entries)
  8. 2696513Domain d1quua2: 1quu A:125-248 [16321]
    Other proteins in same PDB: d1quua3
    two central spectrin-like repeats

Details for d1quua2

PDB Entry: 1quu (more details), 2.5 Å

PDB Description: crystal structure of two central spectrin-like repeats from alpha- actinin
PDB Compounds: (A:) human skeletal muscle alpha-actinin 2

SCOPe Domain Sequences for d1quua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]}
etidqlhlefakraapfnnwmegamedlqdmfivhsieeiqslitaheqfkatlpeadge
rqsimaiqnevekviqsynirisssnpystvtmdelrtkwdkvkqlvpirdqslqeelar
qhan

SCOPe Domain Coordinates for d1quua2:

Click to download the PDB-style file with coordinates for d1quua2.
(The format of our PDB-style files is described here.)

Timeline for d1quua2: