Lineage for d1quua1 (1quu A:1-124)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.7: Spectrin repeat-like [46965] (6 superfamilies) Superfamily a.7.1: Spectrin repeat [46966] (1 family) 
Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
this is a repeat family; one repeat unit is 1hci A:512-632 found in domain
Protein alpha-actinin [46971] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46972] (1 PDB entry) 
Domain d1quua1: 1quu A:1-124 [16320]
Details for d1quua1
PDB Entry: 1quu (more details), 2.5 Å
PDB Description: crystal structure of two central spectrin-like repeats from alpha- actinin
SCOP Domain Sequences for d1quua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens)}
gssneirrlerlehlaekfrqkasthetwaygkeqillqkdyesasltevrallrkheaf
esdlaahqdrveqiaaiaqelneldyhdavnvndrcqkicdqwdrlgtltqkrrealerm
ekll
SCOP Domain Coordinates for d1quua1:
Click to download the PDB-style file with coordinates for d1quua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1quua1:
- d1quua1 appears in SCOP 1.57
- d1quua1 appears in the current release, SCOPe 2.08
View in 3D
