Lineage for d1quua1 (1quu A:1-124)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1840Fold a.7: Spectrin repeat-like [46965] (6 superfamilies)
  4. 1841Superfamily a.7.1: Spectrin repeat [46966] (1 family) (S)
  5. 1842Family a.7.1.1: Spectrin repeat [46967] (2 proteins)
  6. 1843Protein alpha-actinin [46971] (1 species)
  7. 1844Species Human (Homo sapiens) [TaxId:9606] [46972] (1 PDB entry)
  8. 1845Domain d1quua1: 1quu A:1-124 [16320]

Details for d1quua1

PDB Entry: 1quu (more details), 2.5 Å

PDB Description: crystal structure of two central spectrin-like repeats from alpha- actinin
PDB Compounds: (A:)

SCOP Domain Sequences for d1quua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens)}
gssneirrlerlehlaekfrqkasthetwaygkeqillqkdyesasltevrallrkheaf
esdlaahqdrveqiaaiaqelneldyhdavnvndrcqkicdqwdrlgtltqkrrealerm
ekll

SCOP Domain Coordinates for d1quua1:

Click to download the PDB-style file with coordinates for d1quua1.
(The format of our PDB-style files is described here.)

Timeline for d1quua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1quua2