![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
![]() | Protein automated matches [190322] (4 species) not a true protein |
![]() | Species Thermobifida fusca [TaxId:2021] [187474] (1 PDB entry) |
![]() | Domain d2bmma_: 2bmm A: [163124] automated match to d1ngka_ complexed with act, hem |
PDB Entry: 2bmm (more details), 2.48 Å
SCOPe Domain Sequences for d2bmma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmma_ a.1.1.1 (A:) automated matches {Thermobifida fusca [TaxId: 2021]} mtfyeavggeetftrlarrfyegvaadpvlrpmypeedlgpaeerlrlflmqywggprty serrghprlrmrhfpyrigaeerdrwlthmraavddlalpahleqqlweylvyaayamvn vpe
Timeline for d2bmma_: