Lineage for d2bmma_ (2bmm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685880Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2685940Protein automated matches [190322] (4 species)
    not a true protein
  7. 2685961Species Thermobifida fusca [TaxId:2021] [187474] (1 PDB entry)
  8. 2685962Domain d2bmma_: 2bmm A: [163124]
    automated match to d1ngka_
    complexed with act, hem

Details for d2bmma_

PDB Entry: 2bmm (more details), 2.48 Å

PDB Description: x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca
PDB Compounds: (A:) thermostable hemoglobin from thermobifida fusca

SCOPe Domain Sequences for d2bmma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmma_ a.1.1.1 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
mtfyeavggeetftrlarrfyegvaadpvlrpmypeedlgpaeerlrlflmqywggprty
serrghprlrmrhfpyrigaeerdrwlthmraavddlalpahleqqlweylvyaayamvn
vpe

SCOPe Domain Coordinates for d2bmma_:

Click to download the PDB-style file with coordinates for d2bmma_.
(The format of our PDB-style files is described here.)

Timeline for d2bmma_: