Lineage for d1eiyb2 (1eiy B:400-474)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636570Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 636571Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 636572Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
    duplication: contains two such domains related by pseudo dyad
  6. 636573Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 636574Species Thermus thermophilus [TaxId:274] [46958] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 636592Domain d1eiyb2: 1eiy B:400-474 [16306]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb2

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOP Domain Sequences for d1eiyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOP Domain Coordinates for d1eiyb2:

Click to download the PDB-style file with coordinates for d1eiyb2.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb2: