Lineage for d1eiyb5 (1eiy B:475-681)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730673Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (15 proteins)
  6. 730799Protein Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain [55703] (1 species)
    this domain is non-catalytic
  7. 730800Species Thermus thermophilus [TaxId:274] [55704] (9 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 730809Domain d1eiyb5: 1eiy B:475-681 [40782]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb3, d1eiyb4, d1eiyb6

Details for d1eiyb5

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOP Domain Sequences for d1eiyb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]}
alpaffpapdnrgveapyrkeqrlrevlsglgfqevytysfmdpedarrfrldpprllll
nplapekaalrthlfpglvrvlkenldldrperallfevgrvfrereethlagllfgegv
glpwakerlsgyfllkgylealfarlglafrveaqafpflhpgvsgrvlvegeevgflga
lhpeiaqelelppvhlfelrlplpdkp

SCOP Domain Coordinates for d1eiyb5:

Click to download the PDB-style file with coordinates for d1eiyb5.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb5: