Class a: All alpha proteins [46456] (138 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) |
Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) |
Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein) |
Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species) |
Species Thermus thermophilus (Thermus aquaticus) [46958] (4 PDB entries) |
PDB Entry: 1eiy (more details), 3.3 Å
SCOP Domain Sequences for d1eiyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)} ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl veevariqgyetipl
Timeline for d1eiyb2: