SCOP 1.61: Domain d1eiyb2: 1eiy B:400-474

Lineage for d1eiyb2 (1eiy B:400-474)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (5 families)

5. Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)

6. Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)

8. Domain d1eiyb2: 1eiy B:400-474 [16306]
   Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb2

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb2:

Sequence; same for both SEQRES and ATOM records:

>d1eiyb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

Timeline for d1eiyb2:

• d1eiyb2 first appeared (with stable ids) in SCOP 1.55
  
• d1eiyb2 appears in SCOP 1.59
  
• d1eiyb2 appears in SCOP 1.63
  
• d1eiyb2 appears in the current release, SCOPe 2.08