Lineage for d1eiyb2 (1eiy B:400-474)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 95694Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
  4. 95695Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families) (S)
  5. 95696Family a.6.1.1: Domains B1 and B5 of PheRS-beta, PheT [46956] (1 protein)
  6. 95697Protein Domains B1 and B5 of PheRS-beta, PheT [46957] (1 species)
  7. 95698Species Thermus thermophilus (Thermus aquaticus) [46958] (5 PDB entries)
  8. 95708Domain d1eiyb2: 1eiy B:400-474 [16306]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb3, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb2

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb2 a.6.1.1 (B:400-474) Domains B1 and B5 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
ppeaipfrpeyanrllgtsypeaeqiailkrlgcrvegegptyrvtppshrldlrleedl
veevariqgyetipl

SCOP Domain Coordinates for d1eiyb2:

Click to download the PDB-style file with coordinates for d1eiyb2.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb2: