SCOPe 2.02: Domain d2b1lb_: 2b1l B:

Lineage for d2b1lb_ (2b1l B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187437] (1 PDB entry)

8. Domain d2b1lb_: 2b1l B: [162966]
   automated match to d1z5ye1
   mutant

Details for d2b1lb_

PDB Entry: 2b1l, 1.9 Å

PDB Description: Crystal structure of N-terminal 57 residue deletion mutant of E. coli CcmG protein(residues 58-185)

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbE

SCOPe Domain Sequences for d2b1lb_:

Sequence; same for both SEQRES and ATOM records:

>d2b1lb_ c.47.1.10 (B:) automated matches {Escherichia coli [TaxId: 562]}
mqfyqadvltqgkpvllnvwatwcptcraehqylnqlsaqgirvvgmnykddrqkaiswl
kelgnpyalslfdgdgmlgldlgvygapetflidgngiiryrhagdlnprvweeeikplw
ekyskeaaq

Timeline for d2b1lb_:

• d2b1lb_ first appeared in SCOPe 2.01
  
• d2b1lb_ appears in SCOPe 2.03
  
• d2b1lb_ appears in the current release, SCOPe 2.08